PEPTIDES

Generic Peptides

Our Generic Peptides

Semaglutide, DMF registration planned for 2027
Cat #
Introduction Semaglutide is a long-acting glucagon-like peptide-1 (GLP-1) receptor agonist and a synthetic peptide analog of human GLP-1. It is designed to maintain prolonged biological activity through structural modifications that enhance resistance to enzymatic degradation by dipeptidyl peptidase-4 (DPP-4) and improve receptor-mediated signaling.

By activating the GLP-1 receptor, a class B G protein-coupled receptor (GPCR), semaglutide modulates glucose-dependent insulin secretion, glucagon regulation, and metabolic signaling pathways. Due to its well-characterized pharmacological properties, semaglutide is widely utilized as a research tool for investigating GLP-1 receptor signaling, metabolic regulation, peptide pharmacology, and related biological pathways.
Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
MW 4113.58 g/mol
Reference 1. Lau J, Bloch P, Schäffer L, et al.
Discovery of the once-weekly glucagon-like peptide-1 (GLP-1) analogue semaglutide.
Journal of Medicinal Chemistry. 2015;58(18):7370–7380.
2. Aroda VR, Bain SC, Cariou B, et al.
Efficacy and safety of once-weekly semaglutide versus placebo in subjects with type 2 diabetes (SUSTAIN 1).
Diabetes Care. 2017;40(2):223–232.
3. Marso SP, Bain SC, Consoli A, et al.
Semaglutide and cardiovascular outcomes in patients with type 2 diabetes (SUSTAIN 6).
New England Journal of Medicine. 2016;375(19):1834–1844.
4. Nauck MA, Petrie JR, Sesti G, et al.
A phase 2, randomized, dose-ranging study of the safety and efficacy of semaglutide in subjects with type 2 diabetes.
Diabetes Care. 2016;39(12):2317–2325.
5. Müller TD, Finan B, Bloom SR, et al.
Glucagon-like peptide 1 (GLP-1).
Molecular Metabolism. 2019;30:72–130.
Fields of application
Synonyms Semaglutide, NNC 0113-0217, NN9535, NNC0113-0217, GLP-1 analog, Glucagon-like peptide-1 analog, GLP-1 receptor agonist, Long-acting GLP-1 receptor agonist, Human glucagon-like peptide-1 (7-37) analog, [Aib8, Arg34, Lys26]-GLP-1 (7-37) derivative
Structure
목록